RegulonDB RegulonDB 10.9: Amino acid Sequence
periplasmic phosphoanhydride phosphatase/multiple inositol-polyphosphate phosphatase Amino Acid Sequence


Size: 432

Fasta

 

>periplasmic phosphoanhydride phosphatase/multiple inositol-polyphosphate phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MKAILIPFLSLLIPLTPQSAFAQSEPELKLESVVIVSRHGVRAPTKATQLMQDVTPDAWP
TWPVKLGWLTPRGGELIAYLGHYQRQRLVADGLLAKKGCPQSGQVAIIADVDERTRKTGE
AFAAGLAPDCAITVHTQADTSSPDPLFNPLKTGVCQLDNANVTDAILSRAGGSIADFTGH
RQTAFRELERVLNFPQSNLCLKREKQDESCSLTQALPSELKVSADNVSLTGAVSLASMLT
EIFLLQQAQGMPEPGWGRITDSHQWNTLLSLHNAQFYLLQRTPEVARSRATPLLDLIKTA
LTPHPPQKQAYGVTLPTSVLFIAGHDTNLANLGGALELNWTLPGQPDNTPPGGELVFERW
RRLSDNSQWIQVSLVFQTLQQMRDKTPLSLNTPPGEVKLTLAGCEERNAQGMCSLAGFTQ
IVNEARIPACSL
              
                            

Download fasta file
RegulonDB