RegulonDB RegulonDB 10.8: Amino acid Sequence
asparagine—tRNA ligase Amino Acid Sequence


Size: 466

Fasta

 

>asparagine—tRNA ligase E. coli K12. Version NC_000913.3 GI:556503834
MSVVPVADVLQGRVAVDSEVTVRGWVRTRRDSKAGISFLAVYDGSCFDPVQAVINNSLPN
YNEDVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTYPMAAKRHSIEY
LREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITASDTEGAGEMFRVS
TLDLENLPRNDQGKVDFDKDFFGKESFLTVSGQLNGETYACALSKIYTFGPTFRAENSNT
SRHLAEFWMLEPEVAFANLNDIAGLAEAMLKYVFKAVLEERADDMKFFAERVDKDAVSRL
ERFIEADFAQVDYTDAVTILENCGRKFENPVYWGVDLSSEHERYLAEEHFKAPVVVKNYP
KDIKAFYMRLNEDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDERMLEMGLNKEDYWWY
RDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTPRNASF
              
                            

Download fasta file
RegulonDB