RegulonDB RegulonDB 10.9: Amino acid Sequence
ATP synthase Fo complex subunit c Amino Acid Sequence


Size: 79

Fasta

 

>ATP synthase F0 complex subunit c E. coli K12. Version NC_000913.3 GI:556503834
MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV
DAIPMIAVGLGLYVMFAVA
              
                            

Download fasta file
RegulonDB