RegulonDB RegulonDB 10.8: Amino acid Sequence
choline dehydrogenase Amino Acid Sequence


Size: 556

Fasta

 

>choline dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRTQMPAALAFPLQGKRY
NWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNALDLDNWAQEPGLENWSYLD
CLPYYRKAETRDMGENDYHGGDGPVSVTTSKPGVNPLFEAMIEAGVQAGYPRTDDLNGYQ
QEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRTHAMTDHIIFDGKRAVGVEWLEG
DSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEFDIPLVHELPGVGENLQDHL
EMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGASNHFEAGGFIRSREEFAWPNI
QYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRIKSRDPHQHPAILFNYMSHEQD
WQEFRDAIRITREIMHQPALDQYRGREISPGVECQTDEQLDEFVRNHAETAFHPCGTCKM
GYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLNATTIMIGEKIADMIRGQEALPRS
TAGYFVANGMPVRAKK
              
                            

Download fasta file
RegulonDB