RegulonDB RegulonDB 10.10: Amino acid Sequence
lysine:cadaverine antiporter Amino Acid Sequence


Size: 444

Fasta

 

>lysine:cadaverine antiporter E. coli K12. Version NC_000913.3 GI:556503834
MSSAKKIGLFACTGVVAGNMMGSGIALLPANLASIGGIAIWGWIISIIGAMSLAYVYARL
ATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITAVSYLSTFFPVLNDPVP
AGIACIAIVWVFTFVNMLGGTWVSRLTTIGLVLVLIPVVMTAIVGWHWFDAATYAANWNT
ADTTDGHAIIKSILLCLWAFVGVESAAVSTGMVKNPKRTVPLATMLGTGLAGIVYIAATQ
VLSGMYPSSVMAASGAPFAISASTILGNWAAPLVSAFTAFACLTSLGSWMMLVGQAGVRA
ANDGNFPKVYGEVDSNGIPKKGLLLAAVKMTALMILITLMNSAGGKASDLFGELTGIAVL
LTMLPYFYSCVDLIRFEGVNIRNFVSLICSVLGCVFCFIALMGASSFELAGTFIVSLIIL
MFYARKMHERQSHSMDNHTASNAH
              
                            

Download fasta file
RegulonDB