RegulonDB RegulonDB 10.8: Amino acid Sequence
carbamoyl phosphate synthetase subunit α Amino Acid Sequence


Size: 382

Fasta

 

>carbamoyl phosphate synthetase subunit α E. coli K12. Version NC_000913.3 GI:556503834
MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHI
GNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTR
LLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGG
LPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSN
GPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDV
EKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGP
HDAAPLFDHFIELIEQYRKTAK
              
                            

Download fasta file
RegulonDB