RegulonDB RegulonDB 10.8: Amino acid Sequence
protein-glutamate methylesterase/protein glutamine deamidase Amino Acid Sequence


Size: 349

Fasta

 

>protein-glutamate methylesterase/protein glutamine deamidase E. coli K12. Version NC_000913.3 GI:556503834
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYN
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELSRSG
ANYQIKIHDGPAVNRHRPSVDVLFHSVAKQAGRNAVGVILTGMGNDGAAGMLAMRQAGAW
TLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQMLAKISAGQAIRI
              
                            

Download fasta file
RegulonDB