RegulonDB RegulonDB 10.8: Amino acid Sequence
chemotaxis protein CheZ Amino Acid Sequence


Size: 214

Fasta

 

>chemotaxis protein CheZ E. coli K12. Version NC_000913.3 GI:556503834
MMQPSIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQ
MTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLAD
VPAHTSFTNAQLLEIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLENIPEQESRPKR
ENQSLLNGPQVDTSKAGVVASQDQVDDLLDSLGF
              
                            

Download fasta file
RegulonDB