RegulonDB RegulonDB 10.8: Amino acid Sequence
cytochrome bo3 ubiquinol oxidase subunit 2 Amino Acid Sequence


Size: 315

Fasta

 

>cytochrome bo3 ubiquinol oxidase subunit 2 E. coli K12. Version NC_000913.3 GI:556503834
MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAIL
MAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPL
AHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLG
SQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAAFDQWVAKAKQ
SPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFMAHGKSMDMTQPEGEHSAH
EGMEGMDMSHAESAH
              
                            

Download fasta file
RegulonDB