RegulonDB RegulonDB 11.1: Amino acid Sequence
adenylyl-sulfate kinase Amino Acid Sequence


Size: 201

Fasta

 

>adenylyl-sulfate kinase E. coli K12. Version NC_000913.3 GI:556503834
MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTY
LLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRE
RVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQ
LVTNLVQQLLDLLRQNDIIRS
              
                            

Download fasta file
RegulonDB