RegulonDB RegulonDB 11.0: Amino acid Sequence
putative flagella assembly protein Amino Acid Sequence


Size: 331

Fasta

 

>putative flagella assembly protein E. coli K12. Version NC_000913.3 GI:556503834
MIQPISGPPPGQPPGQGDNLPSGTGNQPLSSQQRTSLESLMTKVTSLTQQQRAELWAGIR
HDIGLSGDSPLLSRHFPAAEHNLAQRLLAAQKSHSARQLLAQLGEYLRLGNNRQAVTDYI
RHNFGQTPLNQLSPEQLKTILTLLQEGKMVIPQPQQREATDRPLLPAEHNALKQLVTKLA
AATGEPSKQIWQSMLELSGVKDGELIPAKLFNHLVTWLQARQTLSQQNTPTLESLQMTLK
QPLDASELAALSAYIQQKYGLSAQSSLSSAQAEDILNQLYQRRVKGIDPRVMQPLLNPFP
PMMDTLQNMATRPALWILLVAIILMLVWLVR
              
                            

Download fasta file
RegulonDB