RegulonDB RegulonDB 10.7: Amino acid Sequence
KHG/KDPG aldolase Amino Acid Sequence


Size: 213

Fasta

 

>KHG/KDPG aldolase E. coli K12. Version NC_000913.3 GI:556503834
MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAI
AKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSE
LMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLC
IGGSWLVPADALEAGDYDRITKLAREAVEGAKL
              
                            

Download fasta file
RegulonDB