RegulonDB RegulonDB 10.10: Amino acid Sequence
ferric citrate ABC transporter periplasmic binding protein Amino Acid Sequence


Size: 300

Fasta

 

>ferric citrate ABC transporter periplasmic binding protein E. coli K12. Version NC_000913.3 GI:556503834
MLAFIRFLFAGLLLVISHAFAATVQDEHGTFTLEKTPQRIVVLELSFADALAAVDVIPIG
IADDNDAKRILPEVRAHLKPWQSVGTRAQPSLEAIAALKPDLIIADSSRHAGVYIALQQI
APVLLLKSRNETYAENLQSAAIIGEMVGKKREMQARLEQHKERMAQWASQLPKGTRVAFG
TSREQQFNLHTQETWTGSVLASLGLNVPAAMAGASMPSIGLEQLLAVNPAWLLVAHYREE
SIVKRWQQDPLWQMLTAAQKQQVASVDSNTWARMRGIFAAERIAADTVKIFHHQPLTVVK
              
                            

Download fasta file
RegulonDB