RegulonDB RegulonDB 10.10: Amino acid Sequence
ferric citrate regulator FecR Amino Acid Sequence


Size: 317

Fasta

 

>regulator for fec operon, periplasmic E. coli K12. Version NC_000913.3 GI:556503834
MNPLLTDSRRQALRSASHWYAVLSGERVSPQQEARWQQWYEQDQDNQWAWQQVENLRNQL
GGVPGDVASRALHDTRLTRRHVMKGLLLLLGAGGGWQLWQSETGEGLRADYRTAKGTVSR
QQLEDGSLLTLNTQSAADVRFDAHQRTVRLWYGEIAITTAKDALQRPFRVLTRQGQLTAL
GTEFTVRQQDNFTQLDVQQHAVEVLLASAPAQKRIVNAGESLQFSASEFGAVKPLDDEST
SWTKDILSFSDKPLGEVIATLTRYRNGVLRCDPAVAGLRLSGTFPLKNTDAILNVIAQTL
PVKIQSITRYWINISPL
              
                            

Download fasta file
RegulonDB