RegulonDB RegulonDB 10.8: Amino acid Sequence
signal recognition particle protein component Amino Acid Sequence


Size: 453

Fasta

 

>signal recognition particle protein component E. coli K12. Version NC_000913.3 GI:556503834
MFDNLTDRLSRTLRNISGRGRLTEDNVKDTLREVRMALLEADVALPVVREFINRVKEKAV
GHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKL
GKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAK
LKFYDVLLVDTAGRLHVDEAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEAL
PLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEALEPFHPDRIASRILGMGDV
LSLIEDIESKVDRAQAEKLASKLKKGDGFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQI
PDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGMQVQDVNRLLKQF
DDMQRMMKKMKKGGMAKMMRSMKGMMPPGFPGR
              
                            

Download fasta file
RegulonDB