RegulonDB RegulonDB 11.0: Amino acid Sequence
regulator for fimA Amino Acid Sequence


Size: 198

Fasta

 

>regulator for fimA E. coli K12. Version NC_000913.3 GI:556503834
MSKRRYLTGKEVQAMMQAVCYGATGARDYCLILLAYRHGMRISELLDLHYQDLDLNEGRI
NIRRLKNGFSTVHPLRFDEREAVERWTQERANWKGADRTDAIFISRRGSRLSRQQAYRII
RDAGIEAGTVTQTHPHMLRHACGYELAERGADTRLIQDYLGHRNIRHTVRYTASNAARFA
GLWERNNLINEKLKREEV
              
                            

Download fasta file
RegulonDB