RegulonDB RegulonDB 10.8: Amino acid Sequence
flagellar motor switch protein FliN Amino Acid Sequence


Size: 137

Fasta

 

>flagellar motor switch protein FliN E. coli K12. Version NC_000913.3 GI:556503834
MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDI
PVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGV
RITDIITPSERMRRLSR
              
                            

Download fasta file
RegulonDB