RegulonDB RegulonDB 10.9: Amino acid Sequence
fumarate reductase iron-sulfur protein Amino Acid Sequence


Size: 244

Fasta

 

>fumarate reductase iron-sulfur protein E. coli K12. Version NC_000913.3 GI:556503834
MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRM
AICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPY
IIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRY
NEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIAT
LKPR
              
                            

Download fasta file
RegulonDB