RegulonDB RegulonDB 10.9: Amino acid Sequence
fumarate reductase membrane protein FrdC Amino Acid Sequence


Size: 131

Fasta

 

>fumarate reductase membrane protein FrdC E. coli K12. Version NC_000913.3 GI:556503834
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF
VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA
TIVILFVALYW
              
                            

Download fasta file
RegulonDB