RegulonDB RegulonDB 10.8: Amino acid Sequence
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin) Amino Acid Sequence


Size: 372

Fasta

 

>(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin) E. coli K12. Version NC_000913.3 GI:556503834
MHNQAPIQRRKSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVEATVNQIKALERVGADIVR
VSVPTMDAAEAFKLIKQQVNVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNEERIRM
VVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLESAMRHVDHLDRLNFDQFKVSV
KASDVFLAVESYRLLAKQIDQPLHLGITEAGGARSGAVKSAIGLGLLLSEGIGDTLRVSL
AADPVEEIKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNALEQRLEDIITPMDV
SIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGVRKDRLDNNDMIDQLEARIRAKASQLD
EARRIDVQQVEK
              
                            

Download fasta file
RegulonDB