RegulonDB RegulonDB 10.8: Amino acid Sequence
imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase Amino Acid Sequence


Size: 355

Fasta

 

>imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MSQKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPELLKLQKAGYKLVMITNQDGLG
TQSFPQADFDGPHNLMMQIFTSQGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAM
DRANSYVIGDRATDIQLAENMGITGLRYDRETLNWPMIGEQLTRRDRYAHVVRNTKETQI
DVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGDLYIDDHHTVEDTGLALG
EALKIALGDKRGICRFGFVLPMDECLARCALDISGRPHLEYKAEFTYQRVGDLSTEMIEH
FFRSLSYTMGVTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRVEGDTLPSSKGVL
              
                            

Download fasta file
RegulonDB