RegulonDB RegulonDB 10.8: Amino acid Sequence
imidazole glycerol phosphate synthase subunit HisF Amino Acid Sequence


Size: 258

Fasta

 

>imidazole glycerol phosphate synthase subunit HisF E. coli K12. Version NC_000913.3 GI:556503834
MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV
VDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRF
GVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMN
QDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN
IGELKAYLATQGVEIRIC
              
                            

Download fasta file
RegulonDB