RegulonDB RegulonDB 10.8: Amino acid Sequence
putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase Amino Acid Sequence


Size: 203

Fasta

 

>putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase E. coli K12. Version NC_000913.3 GI:556503834
MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQR
LWTKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQ
LLAERKSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHL
LVLLQDQGLDLTTVIENLRKRHQ
              
                            

Download fasta file
RegulonDB