RegulonDB RegulonDB 10.8: Amino acid Sequence
regulator of the transcriptional regulator FhlA Amino Acid Sequence


Size: 153

Fasta

 

>regulator of the transcriptional regulator FhlA E. coli K12. Version NC_000913.3 GI:556503834
MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHAMSCAPDKELCFVLFE
HFRIYVTLADGFNSHTIEYYVETKDGEDKQRIAQAQLSIDGMIDGKVNIRDREQVLEHYL
EKIAGVYDSLYTAIENNVPVNLSQLVKGQSPAA
              
                            

Download fasta file
RegulonDB