RegulonDB RegulonDB 10.8: Amino acid Sequence
formate hydrogenlyase subunit HycC Amino Acid Sequence


Size: 608

Fasta

 

>formate hydrogenlyase subunit HycC E. coli K12. Version NC_000913.3 GI:556503834
MSAISLINSGVAWFVAAAVLAFLFSFQKALSGWIAGIGGAVGSLYTAAAGFTVLTGAVGV
SGALSLVSYDVQISPLNAIWLITLGLCGLFVSLYNIDWHRHAQVKCNGLQINMLMAAAVC
AVIASNLGMFVVMAEIMALCAVFLTSNSKEGKLWFALGRLGTLLLAIACWLLWQRYGTLD
LRLLDMRMQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAHANASAPAAALFSTVVMKI
GLLGILTLSLLGGNAPLWWGIALLVLGMITAFVGGLYALVEHNIQRLLAYHTLENIGIIL
LGLGAGVTGIALEQPALIALGLVGGLYHLLNHSLFKSVLFLGAGSVWFRTGHRDIEKLGG
IGKKMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFFKLSNSGAFVARLLGPLLAVGL
AITGALAVMCMAKVYGVTFLGAPRTKEAENATCAPLLMSVSVVALAICCVIGGVAAPWLL
PMLSAAVPLPLEPANTTVSQPMITLLLIACPLLPFIIMAICKGDRLPSRSRGAAWVCGYD
HEKSMVITAHGFAMPVKQAFAPVLKLRKWLNPVSLVPGWQCEGSALLFRRMALVELAVLV
VIIVSRGA
              
                            

Download fasta file
RegulonDB