RegulonDB RegulonDB 10.8: Amino acid Sequence
formate hydrogenlyase assembly protein Amino Acid Sequence


Size: 136

Fasta

 

>formate hydrogenlyase assembly protein E. coli K12. Version NC_000913.3 GI:556503834
MSEKVVFSQLSRKFIDENDATPAEAQQVVYYSLAIGHHLGVIDCLEAALTCPWDEYLAWI
ATLEAGSEARRKMEGVPKYGEIVIDINHVPMLANAFDKARAAQTSQQQEWSTMLLSMLHD
IHQENAIYLMVRRLRD
              
                            

Download fasta file
RegulonDB