RegulonDB RegulonDB 10.10: Amino acid Sequence
DNA-binding transcriptional activator ZraR Amino Acid Sequence


Size: 441

Fasta

 

>DNA-binding transcriptional activator ZraR E. coli K12. Version NC_000913.3 GI:556503834
MTHDNIDILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMA
EMDGIATLKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKA
LAHTHSIDAETPAVTASQFGMVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVAR
AIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLD
EIGDISPMMQVRLLRAIQEREVQRVGSNQIISVDVRLIAATHRDLAAEVNAGRFRQDLYY
RLNVVAIEVPSLRQRREDIPLLAGHFLQRFAERNRKAVKGFTPQAMDLLIHYDWPGNIRE
LENAVERAVVLLTGEYISERELPLAIASTPIPLGQSQDIQPLVEVEKEVILAALEKTGGN
KTEAARQLGITRKTLLAKLSR
              
                            

Download fasta file
RegulonDB