RegulonDB RegulonDB 10.8: Amino acid Sequence
hydrogenase 3 nickel incorporation protein HypA Amino Acid Sequence


Size: 116

Fasta

 

>hydrogenase 3 nickel incorporation protein HypA E. coli K12. Version NC_000913.3 GI:556503834
MHEITLCQRALELIEQQAAKHGAKRVTGVWLKIGAFSCVETSSLAFCFDLVCRGSVAEGC
KLHLEEQEAECWCETCQQYVTLLTQRVRRCPQCHGDMLQIVADDGLQIRRIEIDQE
              
                            

Download fasta file
RegulonDB