RegulonDB RegulonDB 10.8: Amino acid Sequence
hydrogenase isoenzymes nickel incorporation protein HypB Amino Acid Sequence


Size: 290

Fasta

 

>hydrogenase isoenzymes nickel incorporation protein HypB E. coli K12. Version NC_000913.3 GI:556503834
MCTTCGCGEGNLYIEGDEHNPHSAFRSAPFAPAARPKMKITGIKAPEFTPSQTEEGDLHY
GHGEAGTHAPGMSQRRMLEVEIDVLDKNNRLAERNRARFAARKQLVLNLVSSPGSGKTTL
LTETLMRLKDSVPCAVIEGDQQTVNDAARIRATGTPAIQVNTGKGCHLDAQMIADAAPRL
PLDDNGILFIENVGNLVCPASFDLGEKHKVAVLSVTEGEDKPLKYPHMFAAASLMLLNKV
DLLPYLNFDVEKCIACAREVNPEIEIILISATSGEGMDQWLNWLETQRCA
              
                            

Download fasta file
RegulonDB