RegulonDB RegulonDB 10.8: Amino acid Sequence
Fe-(CN)2CO cofactor assembly scaffold protein HypD Amino Acid Sequence


Size: 373

Fasta

 

>Fe-(CN)2CO cofactor assembly scaffold protein HypD E. coli K12. Version NC_000913.3 GI:556503834
MRFVDEYRAPEQVMQLIEHLRERASHLSYTAERPLRIMEVCGGHTHAIFKFGLDQLLPEN
VEFIHGPGCPVCVLPMGRIDTCVEIASHPEVIFCTFGDAMRVPGKQGSLLQAKARGADVR
IVYSPMDALKLAQENPTRKVVFFGLGFETTMPTTAITLQQAKARDVQNFYFFCQHITLIP
TLRSLLEQPDNGIDAFLAPGHVSMVIGTDAYNFIASDFHRPLVVAGFEPLDLLQGVVMLV
QQKIAAHSKVENQYRRVVPDAGNLLAQQAIADVFCVNGDSEWRGLGVIESSGVHLTPDYQ
RFDAEAHFRPAPQQVCDDPRARCGEVLTGKCKPHQCPLFGNTCNPQTAFGALMVSSEGAC
AAWYQYRQQESEA
              
                            

Download fasta file
RegulonDB