RegulonDB RegulonDB 10.9: Amino acid Sequence
acetolactate synthase II subunit IlvM Amino Acid Sequence


Size: 87

Fasta

 

>acetolactate synthase II subunit IlvM E. coli K12. Version NC_000913.3 GI:556503834
MMQHQVNVSARFNPETLERVLRVVRHRGFHVCSMNMAAASDAQNINIELTVASPRSVDLL
FSQLNKLVDVAHVAICQSTTTSQQIRA
              
                            

Download fasta file
RegulonDB