RegulonDB RegulonDB 11.0: Amino acid Sequence
maltose regulon periplasmic protein Amino Acid Sequence


Size: 306

Fasta

 

>maltose regulon periplasmic protein E. coli K12. Version NC_000913.3 GI:556503834
MKMNKSLIVLCLSAGLLASAPGISLADVNYVPQNTSDAPAIPSAALQQLTWTPVDQSKTQ
TTQLATGGQQLNVPGISGPVAAYSVPANIGELTLTLTSEVNKQTSVFAPNVLILDQNMTP
SAFFPSSYFTYQEPGVMSADRLEGVMRLTPALGQQKLYVLVFTTEKDLQQTTQLLDPAKA
YAKGVGNSIPDIPDPVARHTTDGLLKLKVKTNSSSSVLVGPLFGSSAPAPVTVGNTAAPA
VAAPAPAPVKKSEPMLNDTESYFNTAIKNAVAKGDVDKALKLLDEAERLGSTSARSTFIS
SVKGKG
              
                            

Download fasta file
RegulonDB