RegulonDB RegulonDB 10.8: Amino acid Sequence
antitoxin of the MazF-MazE toxin-antitoxin system MazE Amino Acid Sequence


Size: 82

Fasta

 

>antitoxin of the MazF-MazE toxin-antitoxin system MazE E. coli K12. Version NC_000913.3 GI:556503834
MIHSSVKRWGNSPAVRIPATLMQALNLNIDDEVKIDLVDGKLIIEPVRKEPVFTLAELVN
DITPENLHENIDWGEPKDKEVW
              
                            

Download fasta file
RegulonDB