RegulonDB RegulonDB 10.8: Amino acid Sequence
nucleoside triphosphate pyrophosphohydrolase Amino Acid Sequence


Size: 263

Fasta

 

>nucleoside triphosphate pyrophosphohydrolase E. coli K12. Version NC_000913.3 GI:556503834
MNQIDRLLTIMQRLRDPENGCPWDKEQTFATIAPYTLEETYEVLDAIAREDFDDLRGELG
DLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFADSSAENSSEVLARWEQIKT
EERAQKAQHSALDDIPRSLPALMRAQKIQKRCANVGFDWTTLGPVVDKVYEEIDEVMYEA
RQAVVDQAKLEEEMGDLLFATVNLARHLGTKAEIALQKANEKFERRFREVERIVAARGLE
MTGVDLETMEEVWQQVKRQEIDL
              
                            

Download fasta file
RegulonDB