RegulonDB RegulonDB 10.9: Amino acid Sequence
5,10-methylenetetrahydrofolate reductase Amino Acid Sequence


Size: 296

Fasta

 

>5,10-methylenetetrahydrofolate reductase E. coli K12. Version NC_000913.3 GI:556503834
MSFFHASQRDALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKDRTGLEAAPHLTCIDATPDELRTIARDYWNNGIRHIVALRGD
LPPGSGKPEMYASDLVTLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPAWMAQMFD
GLDDDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPGL
              
                            

Download fasta file
RegulonDB