RegulonDB RegulonDB 10.8: Amino acid Sequence
motility protein B Amino Acid Sequence


Size: 308

Fasta

 

>motility protein B E. coli K12. Version NC_000913.3 GI:556503834
MKNQAHPIIVVKRRKAKSHGAAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIAE
YFRTPLATAVTGGDRISNSESPIPGGGDDYTQSQGEVNKQPNIEELKKRMEQSRLRKLRG
DLDQLIESDPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFRTGSADVEPYMRDILRAIA
PVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELMVGGLDSGKVLRVVG
MAATMRLSDRGPDDAVNRRISLLVLNKQAEQAILHENAESQNEPVSALEKPEVAPQVSVP
TMPSAEPR
              
                            

Download fasta file
RegulonDB