RegulonDB RegulonDB 10.9: Amino acid Sequence
ribonucleoside-diphosphate reductase 1 subunit β Amino Acid Sequence


Size: 376

Fasta

 

>ribonucleoside-diphosphate reductase 1 subunit β E. coli K12. Version NC_000913.3 GI:556503834
MAYTTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDR
IDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHS
RSYTHIIRNIVNDPSVVFDDIVTNEQIQKRAEGISSYYDELIEMTSYWHLLGEGTHTVNG
KTVTVSLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERELMEGNAKIIRLIARDEA
LHLTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQEKDWADYLFRDGSMIGL
NKDILCQYVEYITNIRMQAVGLDLPFQTRSNPIPWINTWLVSDNVQVAPQEVEVSSYLVG
QIDSEVDTDDLSNFQL
              
                            

Download fasta file
RegulonDB