RegulonDB RegulonDB 10.8: Amino acid Sequence
transcription antitermination protein NusB Amino Acid Sequence


Size: 139

Fasta

 

>transcription antitermination protein NusB E. coli K12. Version NC_000913.3 GI:556503834
MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTA
YLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAEDSH
KFVNGVLDKAAPVIRPNKK
              
                            

Download fasta file
RegulonDB