RegulonDB RegulonDB 11.1: Amino acid Sequence
murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB Amino Acid Sequence


Size: 306

Fasta

 

>murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB E. coli K12. Version NC_000913.3 GI:556503834
MLKFILRRCLEAIPTLFILITISFFMMRLAPGSPFTGERTLPPEVMANIEAKYHLNDPIM
TQYFSYLKQLAHGDFGPSFKYKDYSVNDLVASSFPVSAKLGAAAFFLAVILGVSAGVIAA
LKQNTKWDYTVMGLAMTGVVIPSFVVAPLLVMIFAIILHWLPGGGWNGGALKFMILPMVA
LSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAF
VGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIVDVLYAVI
DPKIRY
              
                            

Download fasta file
RegulonDB