RegulonDB RegulonDB 11.0: Amino acid Sequence
murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppC Amino Acid Sequence


Size: 302

Fasta

 

>murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppC E. coli K12. Version NC_000913.3 GI:556503834
MMLSKKNSETLENFSEKLEVEGRSLWQDARRRFMHNRAAVASLIVLVLIALFVILAPMLS
QFAYDDTDWAMMSSAPDMESGHYFGTDSSGRDLLVRVAIGGRISLMVGVAAALVAVVVGT
LYGSLSGYLGGKVDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAIGMVSWLDMA
RIVRGQTLSLKRKEFIEAAQVGGVSTSGIVIRHIVPNVLGVVVVYASLLVPSMILFESFL
SFLGLGTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIGDGLRDALDPK
DR
              
                            

Download fasta file
RegulonDB