RegulonDB RegulonDB 10.7: Amino acid Sequence
osmotically inducible peroxiredoxin OsmC Amino Acid Sequence


Size: 143

Fasta

 

>osmotically inducible peroxiredoxin OsmC E. coli K12. Version NC_000913.3 GI:556503834
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACF
SMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQK
AKAGCPVSQVLKAEITLDYQLKS
              
                            

Download fasta file
RegulonDB