RegulonDB RegulonDB 11.0: Amino acid Sequence
peptidyl-prolyl cis-trans isomerase A Amino Acid Sequence


Size: 190

Fasta

 

>peptidyl-prolyl cis-trans isomerase A E. coli K12. Version NC_000913.3 GI:556503834
MFKSTLAAMAAVFALSALSPAAMAAKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYV
NSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADK
DSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKP
VVILSAKVLP
              
                            

Download fasta file
RegulonDB