RegulonDB RegulonDB 10.8: Amino acid Sequence
glycine betaine ABC transporter periplasmic binding protein ProX Amino Acid Sequence


Size: 330

Fasta

 

>glycine betaine ABC transporter periplasmic binding protein ProX E. coli K12. Version NC_000913.3 GI:556503834
MRHSVLFATAFATLISTQTFAADLPGKGITVNPVQSTITEETFQTLLVSRALEKLGYTVN
KPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFYREGVFVNGAAQGYLID
KKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTV
THNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKNA
DTKLPNGANYGFPVSTMHIVANKAWAEKNPAAAKLFAIMQLPVADINAQNAIMHDGKASE
GDIQGHVDGWIKAHQQQFDGWVNEALAAQK
              
                            

Download fasta file
RegulonDB