RegulonDB RegulonDB 10.8: Amino acid Sequence
phosphocarrier protein HPr Amino Acid Sequence


Size: 85

Fasta

 

>phosphocarrier protein HPr E. coli K12. Version NC_000913.3 GI:556503834
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE
              
                            

Download fasta file
RegulonDB