RegulonDB RegulonDB 10.8: Amino acid Sequence
orotidine-5'-phosphate decarboxylase Amino Acid Sequence


Size: 245

Fasta

 

>orotidine-5'-phosphate decarboxylase E. coli K12. Version NC_000913.3 GI:556503834
MTLTASSSSRAVTNSPVVVALDYHNRDDALAFVDKIDPRDCRLKVGKEMFTLFGPQFVRE
LQQRGFDIFLDLKFHDIPNTAAHAVAAAADLGVWMVNVHASGGARMMTAAREALVPFGKD
APLLIAVTVLTSMEASDLVDLGMTLSPADYAERLAALTQKCGLDGVVCSAQEAVRFKQVF
GQEFKLVTPGIRPQGSEAGDQRRIMTPEQALSAGVDYMVIGRPVTQSVDPAQTLKAINAS
LQRSA
              
                            

Download fasta file
RegulonDB