RegulonDB RegulonDB 10.10: Amino acid Sequence
ribokinase Amino Acid Sequence


Size: 309

Fasta

 

>ribokinase E. coli K12. Version NC_000913.3 GI:556503834
MQNAGSLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVEAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAPARELPDELLAL
VDIITPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRV
PGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IDAFLDRQR
              
                            

Download fasta file
RegulonDB