RegulonDB RegulonDB 10.8: Amino acid Sequence
DNA repair protein RecN Amino Acid Sequence


Size: 553

Fasta

 

>DNA repair protein RecN E. coli K12. Version NC_000913.3 GI:556503834
MLAQLTISNFAIVRELEIDFHSGMTVITGETGAGKSIAIDALGLCLGGRAEADMVRTGAA
RADLCARFSLKDTPAALRWLEENQLEDGHECLLRRVISSDGRSRGFINGTAVPLSQLREL
GQLLIQIHGQHAHQLLTKPEHQKFLLDGYANETSLLQEMTARYQLWHQSCRDLAHHQQLS
QERAARAELLQYQLKELNEFNPQPGEFEQIDEEYKRLANSGQLLTTSQNALALMADGEDA
NLQSQLYTAKQLVSELIGMDSKLSGVLDMLEEATIQIAEASDELRHYCDRLDLDPNRLFE
LEQRISKQISLARKHHVSPEALPQYYQSLLEEQQQLDDQADSQETLALAVTKHHQQALEI
ARALHQQRQQYAEELAQLITDSMHALSMPHGQFTIDVKFDEHHLGADGADRIEFRVTTNP
GQPMQPIAKVASGGELSRIALAIQVITARKMETPALIFDEVDVGISGPTAAVVGKLLRQL
GESTQVMCVTHLPQVAGCGHQHYFVSKETDGAMTETHMQSLNKKARLQELARLLGGSEVT
RNTLANAKELLAA
              
                            

Download fasta file
RegulonDB