RegulonDB RegulonDB 10.9: Amino acid Sequence
UDP-N-acetylglucosamine—undecaprenyl-phosphate N-acetylglucosaminephosphotransferase Amino Acid Sequence


Size: 367

Fasta

 

>UDP-N-acetylglucosamine—undecaprenyl-phosphate N-acetylglucosaminephosphotransferase E. coli K12. Version NC_000913.3 GI:556503834
MNLLTVSTDLISIFLFTTLFLFFARKVAKKVGLVDKPNFRKRHQGLIPLVGGISVYAGIC
FTFGIVDYYIPHASLYLACAGVLVFIGALDDRFDISVKIRATIQAAVGIVMMVFGKLYLS
SLGYIFGSWEMVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLGGLSCVSFAAIGMILWFD
GQTSLAIWCFAMIAAILPYIMLNLGILGRRYKVFMGDAGSTLIGFTVIWILLETTQGKTH
PISPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIHHLIMRAGFTSRQAFVLITL
AAALLASIGVLAEYSHFVPEWVMLVLFLLAFFLYGYCIKRAWKVARFIKRVKRRLRRNRG
GSPNLTK
              
                            

Download fasta file
RegulonDB