RegulonDB RegulonDB 10.9: Amino acid Sequence
ribosomal protein S6 modification protein Amino Acid Sequence


Size: 300

Fasta

 

>ribosomal protein S6 modification protein E. coli K12. Version NC_000913.3 GI:556503834
MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAASSIHYKGRKLPHFDA
VIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIA
HSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYI
KEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTM
ALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIERHATTEYCLKTGG
              
                            

Download fasta file
RegulonDB