RegulonDB RegulonDB 10.10: Amino acid Sequence
RNA polymerase, sigma 32 (sigma H) factor Amino Acid Sequence


Size: 284

Fasta

 

>RNA polymerase, sigma 32 (sigma H) factor E. coli K12. Version NC_000913.3 GI:556503834
MTDKMQSLALAPVGNLDSYIRAANAWPMLSADEERALAEKLHYHGDLEAAKTLILSHLRF
VVHIARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVEMVARELGVTSKDVREMESRMAAQDM
TFDLSSDDDSDSQPMAPVLYLQDKSSNFADGIEDDNWEEQAANRLTDAMQGLDERSQDII
RARWLDEDNKSTLQELADRYGVSAERVRQLEKNAMKKLRAAIEA
              
                            

Download fasta file
RegulonDB